SCOPe 2.08: Domain d1k74a_: 1k74 A:

Lineage for d1k74a_ (1k74 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
   Uniprot P19793 227-458

8. Domain d1k74a_: 1k74 A: [68251]
   Other proteins in same PDB: d1k74d_
   heterodimer with PPAR-gamma complexed with co-activator peptides
   complexed with 544, 9cr

Details for d1k74a_

PDB Entry: 1k74, 2.3 Å

PDB Description: The 2.3 Angstrom resolution crystal structure of the heterodimer of the human PPARgamma and RXRalpha ligand binding domains respectively bound with GW409544 and 9-cis retinoic acid and co-activator peptides.

PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1k74a_:

Sequence; same for both SEQRES and ATOM records:

>d1k74a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Timeline for d1k74a_:

• d1k74a_ first appeared in SCOP 1.59
  
• d1k74a_ appears in SCOPe 2.07