Lineage for d1k25c3 (1k25 C:2067-2263)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139831Fold d.175: Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56518] (1 superfamily)
  4. 139832Superfamily d.175.1: Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56519] (1 family) (S)
  5. 139833Family d.175.1.1: Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56520] (1 protein)
  6. 139834Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species)
  7. 139835Species Streptococcus pneumoniae [TaxId:1313] [56522] (4 PDB entries)
  8. 139840Domain d1k25c3: 1k25 C:2067-2263 [68043]
    Other proteins in same PDB: d1k25a1, d1k25a2, d1k25a4, d1k25b1, d1k25b2, d1k25b4, d1k25c1, d1k25c2, d1k25c4, d1k25d1, d1k25d2, d1k25d4

Details for d1k25c3

PDB Entry: 1k25 (more details), 3.2 Å

PDB Description: pbp2x from a highly penicillin-resistant streptococcus pneumoniae clinical isolate

SCOP Domain Sequences for d1k25c3:

Sequence, based on SEQRES records: (download)

>d1k25c3 d.175.1.1 (C:2067-2263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Streptococcus pneumoniae}
qitrtvpakrgtiydrngvpiaedatsynvyavidkkyksatgkilyvedaqfnkvaevf
hkyldmeesyvreqlsqpnlkqvsfgskgngityanmmaikkeletaevkgidfttspnr
sypngqfassfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrvgnivp
gtelvsqqtvdgkdvyt

Sequence, based on observed residues (ATOM records): (download)

>d1k25c3 d.175.1.1 (C:2067-2263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Streptococcus pneumoniae}
qitrtvpakrgtiydrngvpiaedatsynvyavttspnrsypngqfassfiglaqlhene
dgsksllgtsgmesslnsilagtdgiitygnivpgtelvsqqtvdgkdvyt

SCOP Domain Coordinates for d1k25c3:

Click to download the PDB-style file with coordinates for d1k25c3.
(The format of our PDB-style files is described here.)

Timeline for d1k25c3: