![]() | Class i: Low resolution protein structures [58117] (18 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Domain d1jzxm_: 1jzx M: [67887] |
PDB Entry: 1jzx (more details), 3.1 Å
SCOP Domain Sequences for d1jzxm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzxm_ i.1.1.2 (M:) 50S subunit {Deinococcus radiodurans} akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
Timeline for d1jzxm_: