Lineage for d1jzxm_ (1jzx M:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (3 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [69993] (6 PDB entries)
  8. 146372Domain d1jzxm_: 1jzx M: [67887]

Details for d1jzxm_

PDB Entry: 1jzx (more details), 3.1 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria

SCOP Domain Sequences for d1jzxm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzxm_ i.1.1.2 (M:) 50S subunit {Deinococcus radiodurans}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOP Domain Coordinates for d1jzxm_:

Click to download the PDB-style file with coordinates for d1jzxm_.
(The format of our PDB-style files is described here.)

Timeline for d1jzxm_: