Lineage for d1jzxm_ (1jzx M:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043709Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 3043770Domain d1jzxm_: 1jzx M: [67887]
    complexed with cly, mg

Details for d1jzxm_

PDB Entry: 1jzx (more details), 3.1 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria
PDB Compounds: (M:) ribosomal protein l32

SCOPe Domain Sequences for d1jzxm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzxm_ i.1.1.2 (M:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d1jzxm_:

Click to download the PDB-style file with coordinates for d1jzxm_.
(The format of our PDB-style files is described here.)

Timeline for d1jzxm_: