Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d1jz6b3: 1jz6 B:13-219 [67797] Other proteins in same PDB: d1jz6a1, d1jz6a2, d1jz6a4, d1jz6a5, d1jz6b1, d1jz6b2, d1jz6b4, d1jz6b5, d1jz6c1, d1jz6c2, d1jz6c4, d1jz6c5, d1jz6d1, d1jz6d2, d1jz6d4, d1jz6d5 complexed with dms, gtz, mg, na |
PDB Entry: 1jz6 (more details), 2.1 Å
SCOPe Domain Sequences for d1jz6b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz6b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jz6b3:
View in 3D Domains from same chain: (mouse over for more information) d1jz6b1, d1jz6b2, d1jz6b4, d1jz6b5 |