Lineage for d1jz6a3 (1jz6 A:13-219)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046412Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2046413Protein beta-Galactosidase [49804] (2 species)
  7. 2046421Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 2046502Domain d1jz6a3: 1jz6 A:13-219 [67792]
    Other proteins in same PDB: d1jz6a1, d1jz6a2, d1jz6a4, d1jz6a5, d1jz6b1, d1jz6b2, d1jz6b4, d1jz6b5, d1jz6c1, d1jz6c2, d1jz6c4, d1jz6c5, d1jz6d1, d1jz6d2, d1jz6d4, d1jz6d5
    complexed with dms, gtz, mg, na

Details for d1jz6a3

PDB Entry: 1jz6 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with galacto-tetrazole
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1jz6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz6a3 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz6a3:

Click to download the PDB-style file with coordinates for d1jz6a3.
(The format of our PDB-style files is described here.)

Timeline for d1jz6a3: