SCOP 1.73: Domain d1jyoe_: 1jyo E:

Lineage for d1jyoe_ (1jyo E:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
   not a true fold

4. Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families)
   not a true superfamily

5. Family d.184.1.2: Virulence effector SptP domain [69868] (1 protein)

6. Protein Virulence effector SptP domain [69869] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [69870] (1 PDB entry)

8. Domain d1jyoe_: 1jyo E: [67487]
   Other proteins in same PDB: d1jyoa_, d1jyob_, d1jyoc_, d1jyod_

Details for d1jyoe_

PDB Entry: 1jyo, 1.9 Å

PDB Description: Structure of the Salmonella Virulence Effector SptP in Complex with its Secretion Chaperone SicP

PDB Compounds: (E:) protein tyrosine phosphatase sptp

SCOP Domain Sequences for d1jyoe_:

Sequence; same for both SEQRES and ATOM records:

>d1jyoe_ d.184.1.2 (E:) Virulence effector SptP domain {Salmonella typhimurium [TaxId: 602]}
dkayvapekfsskvltwlgkmplfkntevvqkhtenirvqdqkilqtflhaltekygeta
vndallmsrinmnkpltqrlavqitecvkaadegfinliksk

Timeline for d1jyoe_:

• d1jyoe_ first appeared in SCOP 1.59
  
• d1jyoe_ appears in SCOP 1.71
  
• d1jyoe_ appears in SCOP 1.75
  
• d1jyoe_ appears in the current release, SCOPe 2.08