Lineage for d1jyoe_ (1jyo E:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615383Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 615384Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 615394Family d.184.1.2: Virulence effector SptP domain [69868] (1 protein)
  6. 615395Protein Virulence effector SptP domain [69869] (1 species)
  7. 615396Species Salmonella typhimurium [TaxId:90371] [69870] (1 PDB entry)
  8. 615397Domain d1jyoe_: 1jyo E: [67487]
    Other proteins in same PDB: d1jyoa_, d1jyob_, d1jyoc_, d1jyod_

Details for d1jyoe_

PDB Entry: 1jyo (more details), 1.9 Å

PDB Description: Structure of the Salmonella Virulence Effector SptP in Complex with its Secretion Chaperone SicP

SCOP Domain Sequences for d1jyoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyoe_ d.184.1.2 (E:) Virulence effector SptP domain {Salmonella typhimurium}
dkayvapekfsskvltwlgkmplfkntevvqkhtenirvqdqkilqtflhaltekygeta
vndallmsrinmnkpltqrlavqitecvkaadegfinliksk

SCOP Domain Coordinates for d1jyoe_:

Click to download the PDB-style file with coordinates for d1jyoe_.
(The format of our PDB-style files is described here.)

Timeline for d1jyoe_: