Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) not a true superfamily |
Family d.184.1.2: Virulence effector SptP domain [69868] (1 protein) |
Protein Virulence effector SptP domain [69869] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [69870] (1 PDB entry) |
Domain d1jyoe_: 1jyo E: [67487] Other proteins in same PDB: d1jyoa_, d1jyob_, d1jyoc_, d1jyod_ |
PDB Entry: 1jyo (more details), 1.9 Å
SCOP Domain Sequences for d1jyoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyoe_ d.184.1.2 (E:) Virulence effector SptP domain {Salmonella typhimurium} dkayvapekfsskvltwlgkmplfkntevvqkhtenirvqdqkilqtflhaltekygeta vndallmsrinmnkpltqrlavqitecvkaadegfinliksk
Timeline for d1jyoe_: