SCOP 1.73: Domain d1jyod_: 1jyo D:

Lineage for d1jyod_ (1jyo D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.198: Secretion chaperone-like [69634] (3 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (9 proteins)
   the family sequences are very divergent

6. Protein Virulence effector SptP secretion chaperone SicP [69639] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [69640] (1 PDB entry)

8. Domain d1jyod_: 1jyo D: [67486]
   Other proteins in same PDB: d1jyoe_, d1jyof_

Details for d1jyod_

PDB Entry: 1jyo, 1.9 Å

PDB Description: Structure of the Salmonella Virulence Effector SptP in Complex with its Secretion Chaperone SicP

PDB Compounds: (D:) SicP

SCOP Domain Sequences for d1jyod_:

Sequence; same for both SEQRES and ATOM records:

>d1jyod_ d.198.1.1 (D:) Virulence effector SptP secretion chaperone SicP {Salmonella typhimurium [TaxId: 602]}
lqahqdiianigeklglpltfddnnqclllldsdiftsieakddiwllngmiiplspvcg
dsiwrqimvingelaannegtlayidaaetlllihaitdltntyhiisqlesfvnqqeal
knilqeyakv

Timeline for d1jyod_:

• d1jyod_ first appeared in SCOP 1.59
  
• d1jyod_ appears in SCOP 1.71
  
• d1jyod_ appears in SCOP 1.75
  
• d1jyod_ appears in the current release, SCOPe 2.08