Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.198: Secretion chaperone-like [69634] (3 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family) |
Family d.198.1.1: Type III secretory system chaperone [69636] (9 proteins) the family sequences are very divergent |
Protein Virulence effector SptP secretion chaperone SicP [69639] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [69640] (1 PDB entry) |
Domain d1jyod_: 1jyo D: [67486] Other proteins in same PDB: d1jyoe_, d1jyof_ |
PDB Entry: 1jyo (more details), 1.9 Å
SCOP Domain Sequences for d1jyod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyod_ d.198.1.1 (D:) Virulence effector SptP secretion chaperone SicP {Salmonella typhimurium [TaxId: 602]} lqahqdiianigeklglpltfddnnqclllldsdiftsieakddiwllngmiiplspvcg dsiwrqimvingelaannegtlayidaaetlllihaitdltntyhiisqlesfvnqqeal knilqeyakv
Timeline for d1jyod_: