SCOP 1.59: Domain d1jyob_: 1jyo B:

Lineage for d1jyob_ (1jyo B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.198: Secretion chaperone-like [69634] (2 superfamilies)

4. Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family)

5. Family d.198.1.1: Type III secretory system chaperone [69636] (4 proteins)

6. Protein Virulence effector SptP secretion chaperone SicP [69639] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [69640] (1 PDB entry)

8. Domain d1jyob_: 1jyo B: [67484]
   Other proteins in same PDB: d1jyoe_, d1jyof_

Details for d1jyob_

PDB Entry: 1jyo, 1.9 Å

PDB Description: Structure of the Salmonella Virulence Effector SptP in Complex with its Secretion Chaperone SicP

SCOP Domain Sequences for d1jyob_:

Sequence; same for both SEQRES and ATOM records:

>d1jyob_ d.198.1.1 (B:) Virulence effector SptP secretion chaperone SicP {Salmonella typhimurium}
lqahqdiianigeklglpltfddnnqclllldsdiftsieakddiwllngmiiplspvcg
dsiwrqimvingelaannegtlayidaaetlllihaitdltntyhiisqlesfvnqqeal
knilqeyakv

Timeline for d1jyob_:

• d1jyob_ is new in SCOP 1.59
  
• d1jyob_ appears in SCOP 1.61
  
• d1jyob_ appears in the current release, SCOPe 2.08