SCOPe 2.08: Domain d1juob_: 1juo B:

Lineage for d1juob_ (1juo B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Sorcin [69023] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69024] (4 PDB entries)

8. Domain d1juob_: 1juo B: [67313]

Details for d1juob_

PDB Entry: 1juo, 2.2 Å

PDB Description: Crystal Structure of Calcium-free Human Sorcin: A Member of the Penta-EF-Hand Protein Family

PDB Compounds: (B:) sorcin

SCOPe Domain Sequences for d1juob_:

Sequence; same for both SEQRES and ATOM records:

>d1juob_ a.39.1.8 (B:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}
fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm
sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak
rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv

Timeline for d1juob_:

• d1juob_ first appeared in SCOP 1.59
  
• d1juob_ appears in SCOPe 2.07