Lineage for d1jrih1 (1jri H:10-81)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396393Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 2396439Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 2396482Domain d1jrih1: 1jri H:10-81 [67128]
    Other proteins in same PDB: d1jria2, d1jrib2, d1jric2, d1jrid2, d1jrie2, d1jrif2, d1jrig2, d1jrih2, d1jrii2, d1jril2, d1jrim2, d1jrin2
    complexed with cl, edo

Details for d1jrih1

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.
PDB Compounds: (H:) Sm-like Archaeal Protein 1 (SmAP1)

SCOPe Domain Sequences for d1jrih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrih1 b.38.1.1 (H:10-81) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
nvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtv
lirgdnivyisr

SCOPe Domain Coordinates for d1jrih1:

Click to download the PDB-style file with coordinates for d1jrih1.
(The format of our PDB-style files is described here.)

Timeline for d1jrih1: