SCOPe 2.07: Domain d1jrif1: 1jri F:11-81

Lineage for d1jrif1 (1jri F:11-81)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
   MTH649, smap1

8. Domain d1jrif1: 1jri F:11-81 [67126]
   Other proteins in same PDB: d1jria2, d1jrib2, d1jric2, d1jrid2, d1jrie2, d1jrif2, d1jrig2, d1jrih2, d1jrii2, d1jril2, d1jrim2, d1jrin2
   complexed with cl, edo

Details for d1jrif1

PDB Entry: 1jri, 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.

PDB Compounds: (F:) Sm-like Archaeal Protein 1 (SmAP1)

SCOPe Domain Sequences for d1jrif1:

Sequence; same for both SEQRES and ATOM records:

>d1jrif1 b.38.1.1 (F:11-81) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyisr

Timeline for d1jrif1:

• d1jrif1 first appeared in SCOP 1.59, called d1jrif_
  
• d1jrif1 appears in SCOPe 2.06
  
• d1jrif1 appears in the current release, SCOPe 2.08