Class b: All beta proteins [48724] (178 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries) MTH649, smap1 |
Domain d1jrib1: 1jri B:12-81 [67122] Other proteins in same PDB: d1jria2, d1jrib2, d1jric2, d1jrid2, d1jrie2, d1jrif2, d1jrig2, d1jrih2, d1jrii2, d1jril2, d1jrim2, d1jrin2 complexed with cl, edo |
PDB Entry: 1jri (more details), 2.8 Å
SCOPe Domain Sequences for d1jrib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrib1 b.38.1.1 (B:12-81) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]} qrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvli rgdnivyisr
Timeline for d1jrib1: