Lineage for d1jmzg_ (1jmz G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925761Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 925909Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) (S)
  5. 925910Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)
  6. 925911Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)
  7. 925915Species Pseudomonas putida [TaxId:303] [69135] (2 PDB entries)
  8. 925917Domain d1jmzg_: 1jmz G: [66914]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza3, d1jmza4, d1jmza5, d1jmzb_
    complexed with hec, ni, pnd

Details for d1jmzg_

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
PDB Compounds: (G:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmzg_ a.137.9.1 (G:) Quinohemoprotein amine dehydrogenase C chain {Pseudomonas putida [TaxId: 303]}
avagctattdpgwevdafggvsslcqpmeadlygcsdpcwwpaqvpdmmstyqdwnaqas
nsaedwrnlgtvfpkdk

SCOPe Domain Coordinates for d1jmzg_:

Click to download the PDB-style file with coordinates for d1jmzg_.
(The format of our PDB-style files is described here.)

Timeline for d1jmzg_: