Lineage for d1jmza3 (1jmz A:282-363)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938140Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 938141Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 938147Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)
  8. 938150Domain d1jmza3: 1jmz A:282-363 [66910]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza5, d1jmzb_, d1jmzg_
    complexed with hec, ni, pnd

Details for d1jmza3

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
PDB Compounds: (A:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmza3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida [TaxId: 303]}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

SCOPe Domain Coordinates for d1jmza3:

Click to download the PDB-style file with coordinates for d1jmza3.
(The format of our PDB-style files is described here.)

Timeline for d1jmza3: