SCOPe 2.01: Domain d1jeba_: 1jeb A:

Lineage for d1jeba_ (1jeb A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (22 species)

7. Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (1 PDB entry)

8. Domain d1jeba_: 1jeb A: [66591]
   Other proteins in same PDB: d1jebb_, d1jebd_
   complexed with cmo, hem

Details for d1jeba_

PDB Entry: 1jeb, 2.1 Å

PDB Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)

PDB Compounds: (A:) hemoglobin zeta chain

SCOPe Domain Sequences for d1jeba_:

Sequence; same for both SEQRES and ATOM records:

>d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]}
sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
ahaawdkflsvvssvltekyr

Timeline for d1jeba_:

• d1jeba_ first appeared in SCOP 1.59
  
• d1jeba_ appears in SCOP 1.75
  
• d1jeba_ appears in SCOPe 2.02
  
• d1jeba_ appears in the current release, SCOPe 2.08