Lineage for d1jeba_ (1jeb A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93753Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (1 PDB entry)
  8. 93754Domain d1jeba_: 1jeb A: [66591]
    Other proteins in same PDB: d1jebb_, d1jebd_

Details for d1jeba_

PDB Entry: 1jeb (more details), 2.1 Å

PDB Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)

SCOP Domain Sequences for d1jeba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform}
sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
ahaawdkflsvvssvltekyr

SCOP Domain Coordinates for d1jeba_:

Click to download the PDB-style file with coordinates for d1jeba_.
(The format of our PDB-style files is described here.)

Timeline for d1jeba_: