SCOPe 2.08: Domain d1i1ga1: 1i1g A:2-61

Lineage for d1i1ga1 (1i1g A:2-61)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
   Swapped dimer with the "wing" C-terminal strands
   automatically mapped to Pfam PF13412

6. Protein LprA [68968] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [68969] (1 PDB entry)

8. Domain d1i1ga1: 1i1g A:2-61 [65982]
   Other proteins in same PDB: d1i1ga2, d1i1gb2

Details for d1i1ga1

PDB Entry: 1i1g, 2.9 Å

PDB Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus

PDB Compounds: (A:) transcriptional regulator lrpa

SCOPe Domain Sequences for d1i1ga1:

Sequence; same for both SEQRES and ATOM records:

>d1i1ga1 a.4.5.32 (A:2-61) LprA {Pyrococcus furiosus [TaxId: 2261]}
iderdkiileilekdartpfteiakklgisetavrkrvkaleekgiiegytikinpkklg

Timeline for d1i1ga1:

• d1i1ga1 first appeared in SCOP 1.59
  
• d1i1ga1 appears in SCOPe 2.07