Lineage for d1i1ga1 (1i1g A:2-61)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95519Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (1 protein)
  6. 95520Protein LprA [68968] (1 species)
  7. 95521Species Archaeon Pyrococcus furiosus [TaxId:2261] [68969] (1 PDB entry)
  8. 95522Domain d1i1ga1: 1i1g A:2-61 [65982]
    Other proteins in same PDB: d1i1ga2, d1i1gb2

Details for d1i1ga1

PDB Entry: 1i1g (more details), 2.9 Å

PDB Description: crystal structure of the lrp-like transcriptional regulator from the archaeon pyrococcus furiosus

SCOP Domain Sequences for d1i1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus}
iderdkiileilekdartpfteiakklgisetavrkrvkaleekgiiegytikinpkklg

SCOP Domain Coordinates for d1i1ga1:

Click to download the PDB-style file with coordinates for d1i1ga1.
(The format of our PDB-style files is described here.)

Timeline for d1i1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i1ga2