Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Xylanase [51488] (6 species) |
Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (8 PDB entries) Uniprot P40943 |
Domain d1hiza_: 1hiz A: [65841] complexed with gla, glc, so4 |
PDB Entry: 1hiz (more details), 2.4 Å
SCOPe Domain Sequences for d1hiza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hiza_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} syakkphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpi siqpeegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvk reqnkqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikva fqaarkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpse aeiektinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklye klsdkisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgp dykvkpaywaiidhk
Timeline for d1hiza_: