Lineage for d1hh2p3 (1hh2 P:277-344)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947289Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947290Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2947373Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
    duplication: tandem repeat of two type II KH-domains
  7. 2947385Species Thermotoga maritima [TaxId:2336] [69702] (2 PDB entries)
  8. 2947387Domain d1hh2p3: 1hh2 P:277-344 [65837]
    Other proteins in same PDB: d1hh2p1, d1hh2p4

Details for d1hh2p3

PDB Entry: 1hh2 (more details), 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima
PDB Compounds: (P:) n utilization substance protein a

SCOPe Domain Sequences for d1hh2p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]}
ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwki
dikpimnl

SCOPe Domain Coordinates for d1hh2p3:

Click to download the PDB-style file with coordinates for d1hh2p3.
(The format of our PDB-style files is described here.)

Timeline for d1hh2p3: