Lineage for d1hh2p3 (1hh2 P:277-344)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133071Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)
  4. 133098Superfamily d.52.3: Prokaryotic type KH domain (pKH-domain) [54814] (1 family) (S)
  5. 133099Family d.52.3.1: Prokaryotic type KH domain (pKH-domain) [54815] (4 proteins)
  6. 133120Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
  7. 133126Species Thermotoga maritima [TaxId:243274] [69702] (1 PDB entry)
  8. 133128Domain d1hh2p3: 1hh2 P:277-344 [65837]
    Other proteins in same PDB: d1hh2p1, d1hh2p4

Details for d1hh2p3

PDB Entry: 1hh2 (more details), 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima

SCOP Domain Sequences for d1hh2p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima}
ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwki
dikpimnl

SCOP Domain Coordinates for d1hh2p3:

Click to download the PDB-style file with coordinates for d1hh2p3.
(The format of our PDB-style files is described here.)

Timeline for d1hh2p3: