SCOP 1.75: Domain d1hcjc_: 1hcj C:

Lineage for d1hcjc_ (1hcj C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (2 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (5 proteins)

6. Protein Green fluorescent protein, GFP [54513] (2 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (53 PDB entries)
   Uniprot P42212

8. Domain d1hcjc_: 1hcj C: [65794]
   Photoproduct of the wild-type GFP

Details for d1hcjc_

PDB Entry: 1hcj, 1.8 Å

PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein

PDB Compounds: (C:) Green fluorescent protein

SCOP Domain Sequences for d1hcjc_:

Sequence; same for both SEQRES and ATOM records:

>d1hcjc_ d.22.1.1 (C:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

Timeline for d1hcjc_:

• d1hcjc_ first appeared in SCOP 1.59
  
• d1hcjc_ appears in SCOP 1.73
  
• d1hcjc_ appears in SCOPe 2.01
  
• d1hcjc_ appears in the current release, SCOPe 2.08