Lineage for d1hcjc_ (1hcj C:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.22: GFP-like [54510] (1 superfamily) Superfamily d.22.1: GFP-like [54511] (2 families) 
Family d.22.1.1: Fluorescent proteins [54512] (2 proteins) Protein Green fluorescent protein, GFP [54513] (1 species) Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (23 PDB entries) 
Domain d1hcjc_: 1hcj C: [65794]
Details for d1hcjc_
PDB Entry: 1hcj (more details), 1.8 Å
PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein
SCOP Domain Sequences for d1hcjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcjc_ d.22.1.1 (C:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria)}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith
SCOP Domain Coordinates for d1hcjc_:
Click to download the PDB-style file with coordinates for d1hcjc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hcjc_:
- d1hcjc_ is new in SCOP 1.59
- d1hcjc_ appears in SCOP 1.61
- d1hcjc_ appears in the current release, SCOPe 2.08
View in 3D
