![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein Green fluorescent protein, GFP [54513] (4 species) |
![]() | Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (123 PDB entries) Uniprot P42212 |
![]() | Domain d1hcjb_: 1hcj B: [65793] Photoproduct of the wild-type GFP |
PDB Entry: 1hcj (more details), 1.8 Å
SCOPe Domain Sequences for d1hcjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcjb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith
Timeline for d1hcjb_: