SCOPe 2.01: Domain d1hcjb_: 1hcj B:

Lineage for d1hcjb_ (1hcj B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (118 PDB entries)
   Uniprot P42212

8. Domain d1hcjb_: 1hcj B: [65793]
   Photoproduct of the wild-type GFP

Details for d1hcjb_

PDB Entry: 1hcj, 1.8 Å

PDB Description: photoproduct of the wild-type aequorea victoria green fluorescent protein

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d1hcjb_:

Sequence; same for both SEQRES and ATOM records:

>d1hcjb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

Timeline for d1hcjb_:

• d1hcjb_ first appeared in SCOP 1.59
  
• d1hcjb_ appears in SCOP 1.75
  
• d1hcjb_ appears in SCOPe 2.02
  
• d1hcjb_ appears in the current release, SCOPe 2.08