Class b: All beta proteins [48724] (176 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein gamma-Crystallin [49697] (8 species) duplication consists of two domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [69202] (1 PDB entry) |
Domain d1ha4a_: 1ha4 A: [65745] C-terminal domain only |
PDB Entry: 1ha4 (more details), 2.4 Å
SCOPe Domain Sequences for d1ha4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha4a_ b.11.1.1 (A:) gamma-Crystallin {Human (Homo sapiens) [TaxId: 9606]} gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl ldkkeyrkpidwgaaspavqsfrrive
Timeline for d1ha4a_: