SCOPe 2.05: Domain d1ha4a_: 1ha4 A:

Lineage for d1ha4a_ (1ha4 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (8 species)
   duplication consists of two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [69202] (1 PDB entry)

8. Domain d1ha4a_: 1ha4 A: [65745]
   C-terminal domain only

Details for d1ha4a_

PDB Entry: 1ha4, 2.4 Å

PDB Description: gammas crystallin c terminal domain from homo sapiens

PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d1ha4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ha4a_ b.11.1.1 (A:) gamma-Crystallin {Human (Homo sapiens) [TaxId: 9606]}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

Timeline for d1ha4a_:

• d1ha4a_ first appeared in SCOP 1.59
  
• d1ha4a_ appears in SCOPe 2.04
  
• d1ha4a_ appears in SCOPe 2.06
  
• d1ha4a_ appears in the current release, SCOPe 2.08