Lineage for d1ha4a_ (1ha4 A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) Protein gamma-Crystallin [49697] (5 species) 
Species Human (Homo sapiens) [TaxId:9606] [69202] (1 PDB entry) 
Domain d1ha4a_: 1ha4 A: [65745]
Details for d1ha4a_
PDB Entry: 1ha4 (more details), 2.4 Å
PDB Description: gammas crystallin c terminal domain from homo sapiens
SCOP Domain Sequences for d1ha4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha4a_ b.11.1.1 (A:) gamma-Crystallin {Human (Homo sapiens)}
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive
SCOP Domain Coordinates for d1ha4a_:
Click to download the PDB-style file with coordinates for d1ha4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ha4a_:
- d1ha4a_ is new in SCOP 1.59
- d1ha4a_ appears in SCOP 1.61
- d1ha4a_ appears in the current release, SCOPe 2.08
View in 3D
