PDB entry 1ha4

View 1ha4 on RCSB PDB site
Description: gammas crystallin c terminal domain from homo sapiens
Deposited on 2001-03-27, released 2001-11-20
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-20, with a file datestamp of 2001-11-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2159
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ha4a_
  • Chain 'B':
    Domains in SCOP 1.59: d1ha4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ha4A (A:)
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ha4B (B:)
gqykiqifekgdfsgqmyettedcpsimeqfhmreihsckvlegvwifyelpnyrgrqyl
ldkkeyrkpidwgaaspavqsfrrive