SCOP 1.69: Domain d1goza1: 1goz A:1001-1121

Lineage for d1goza1 (1goz A:1001-1121)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (12 PDB entries)

8. Domain d1goza1: 1goz A:1001-1121 [65435]
   Other proteins in same PDB: d1goza2, d1gozb2

Details for d1goza1

PDB Entry: 1goz, 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant

SCOP Domain Sequences for d1goza1:

Sequence, based on SEQRES records:

>d1goza1 b.40.2.2 (A:1001-1121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
h

Sequence, based on observed residues (ATOM records):

>d1goza1 b.40.2.2 (A:1001-1121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvteh

Timeline for d1goza1:

• d1goza1 first appeared in SCOP 1.59
  
• d1goza1 appears in SCOP 1.67
  
• d1goza1 appears in SCOP 1.71
  
• d1goza1 appears in the current release, SCOPe 2.08