PDB entry 1goz

View 1goz on RCSB PDB site
Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
Deposited on 2001-10-29, released 2002-02-13
The last revision prior to the SCOP 1.69 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gozA (A:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gozA (A:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvtehngnqldkyr
    sitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfi
    enensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gozB (B:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
    hngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnns
    pyetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gozB (B:)
    esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
    ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvtehngnqldkyr
    sitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgyikfi
    enensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk