Lineage for d1goza1 (1goz A:1001-1121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2788968Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2788969Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2788975Domain d1goza1: 1goz A:1001-1121 [65435]
    Other proteins in same PDB: d1goza2, d1gozb2
    mutant

Details for d1goza1

PDB Entry: 1goz (more details), 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
PDB Compounds: (A:) enterotoxin type b

SCOPe Domain Sequences for d1goza1:

Sequence, based on SEQRES records: (download)

>d1goza1 b.40.2.2 (A:1001-1121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
h

Sequence, based on observed residues (ATOM records): (download)

>d1goza1 b.40.2.2 (A:1001-1121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvteh

SCOPe Domain Coordinates for d1goza1:

Click to download the PDB-style file with coordinates for d1goza1.
(The format of our PDB-style files is described here.)

Timeline for d1goza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1goza2