Lineage for d1go3n_ (1go3 N:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917285Superfamily a.60.8: HRDC-like [47819] (4 families) (S)
  5. 917302Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (1 protein)
  6. 917303Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species)
    includes the N-terminal heterodimerisation alpha-hairpin
  7. 917312Species Methanococcus jannaschii [TaxId:2190] [69046] (1 PDB entry)
  8. 917314Domain d1go3n_: 1go3 N: [65409]
    Other proteins in same PDB: d1go3e1, d1go3e2, d1go3m1, d1go3m2
    protein/DNA complex; protein/RNA complex

Details for d1go3n_

PDB Entry: 1go3 (more details), 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
PDB Compounds: (N:) DNA-directed RNA polymerase subunit f

SCOPe Domain Sequences for d1go3n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go3n_ a.60.8.2 (N:) RNA polymerase II subunit RBP4 (RpoF) {Methanococcus jannaschii [TaxId: 2190]}
igkkilgeryvtvseaaeimynraqigelsyeqgcaldylqkfakldkeeakklveelis
lgidektavkiadilpedlddlraiyykrelpenaeeileivrkyi

SCOPe Domain Coordinates for d1go3n_:

Click to download the PDB-style file with coordinates for d1go3n_.
(The format of our PDB-style files is described here.)

Timeline for d1go3n_: