Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (5 families) |
Family a.60.8.2: RNA polymerase II subunit RBP4 (RpoF) [69044] (2 proteins) |
Protein RNA polymerase II subunit RBP4 (RpoF) [69045] (3 species) includes the N-terminal heterodimerisation alpha-hairpin |
Species Methanococcus jannaschii [TaxId:2190] [69046] (1 PDB entry) |
Domain d1go3n_: 1go3 N: [65409] Other proteins in same PDB: d1go3e1, d1go3e2, d1go3m1, d1go3m2 protein/DNA complex; protein/RNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1go3 (more details), 1.75 Å
SCOPe Domain Sequences for d1go3n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1go3n_ a.60.8.2 (N:) RNA polymerase II subunit RBP4 (RpoF) {Methanococcus jannaschii [TaxId: 2190]} igkkilgeryvtvseaaeimynraqigelsyeqgcaldylqkfakldkeeakklveelis lgidektavkiadilpedlddlraiyykrelpenaeeileivrkyi
Timeline for d1go3n_: