Lineage for d1g49a_ (1g49 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034832Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1035046Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 1035047Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (37 PDB entries)
  8. 1035056Domain d1g49a_: 1g49 A: [65140]
    complexed with 111, ca, zn

Details for d1g49a_

PDB Entry: 1g49 (more details), 1.9 Å

PDB Description: a carboxylic acid based inhibitor in complex with mmp3
PDB Compounds: (A:) matrix metalloproteinase 3

SCOPe Domain Sequences for d1g49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g49a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

SCOPe Domain Coordinates for d1g49a_:

Click to download the PDB-style file with coordinates for d1g49a_.
(The format of our PDB-style files is described here.)

Timeline for d1g49a_: