Lineage for d1g49a_ (1g49 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) 
Domain d1g49a_: 1g49 A: [65140]
Details for d1g49a_
PDB Entry: 1g49 (more details), 1.9 Å
PDB Description: a carboxylic acid based inhibitor in complex with mmp3
SCOP Domain Sequences for d1g49a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g49a_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd
SCOP Domain Coordinates for d1g49a_:
Click to download the PDB-style file with coordinates for d1g49a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g49a_:
- d1g49a_ is new in SCOP 1.59
- d1g49a_ appears in SCOP 1.61
- d1g49a_ appears in the current release, SCOPe 2.08
View in 3D
