![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein E-selectin, EGF-domain [57203] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) |
![]() | Domain d1g1ta2: 1g1t A:119-157 [65105] Other proteins in same PDB: d1g1ta1 complexed with ca |
PDB Entry: 1g1t (more details), 1.5 Å
SCOPe Domain Sequences for d1g1ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} taactntscsghgecvetinnytckcdpgfsglkceqiv
Timeline for d1g1ta2: