SCOP 1.59: Domain d1g1ta2: 1g1t A:119-157

Lineage for d1g1ta2 (1g1t A:119-157)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein E-selectin, EGF-domain [57203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)

8. Domain d1g1ta2: 1g1t A:119-157 [65105]
   Other proteins in same PDB: d1g1ta1

Details for d1g1ta2

PDB Entry: 1g1t, 1.5 Å

PDB Description: crystal structure of e-selectin lectin/egf domains complexed with slex

SCOP Domain Sequences for d1g1ta2:

Sequence; same for both SEQRES and ATOM records:

>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens)}
taactntscsghgecvetinnytckcdpgfsglkceqiv

Timeline for d1g1ta2:

• d1g1ta2 is new in SCOP 1.59
  
• d1g1ta2 appears in SCOP 1.61
  
• d1g1ta2 appears in the current release, SCOPe 2.08