Lineage for d1f9nf1 (1f9n F:1-78)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95188Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)
  6. 95189Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 95197Species Bacillus subtilis [TaxId:1423] [68966] (1 PDB entry)
  8. 95203Domain d1f9nf1: 1f9n F:1-78 [65000]
    Other proteins in same PDB: d1f9na2, d1f9nb2, d1f9nc2, d1f9nd2, d1f9ne2, d1f9nf2

Details for d1f9nf1

PDB Entry: 1f9n (more details), 2.7 Å

PDB Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis

SCOP Domain Sequences for d1f9nf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9nf1 a.4.5.3 (F:1-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis}
mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy
kyslpadqrfnplsklkr

SCOP Domain Coordinates for d1f9nf1:

Click to download the PDB-style file with coordinates for d1f9nf1.
(The format of our PDB-style files is described here.)

Timeline for d1f9nf1: