![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins) automatically mapped to Pfam PF01316 |
![]() | Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries) |
![]() | Domain d1f9nf1: 1f9n F:1-78 [65000] Other proteins in same PDB: d1f9na2, d1f9nb2, d1f9nc2, d1f9nd2, d1f9ne2, d1f9nf2 |
PDB Entry: 1f9n (more details), 2.7 Å
SCOPe Domain Sequences for d1f9nf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f9nf1 a.4.5.3 (F:1-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]} mnkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsy kyslpadqrfnplsklkr
Timeline for d1f9nf1: