Lineage for d1e7lb2 (1e7l B:1-103)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130169Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
  4. 130170Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
  5. 130209Family d.4.1.5: Recombination endonuclease VII, C-terminal and dimerization domains [68915] (1 protein)
  6. 130210Protein Recombination endonuclease VII, C-terminal and dimerization domains [68916] (1 species)
  7. 130211Species Bacteriophage T4 [TaxId:10665] [68917] (3 PDB entries)
  8. 130213Domain d1e7lb2: 1e7l B:1-103 [64731]
    Other proteins in same PDB: d1e7la1, d1e7lb1

Details for d1e7lb2

PDB Entry: 1e7l (more details), 1.32 Å

PDB Description: endonuclease vii (endovii) n62d mutant from phage t4

SCOP Domain Sequences for d1e7lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7lb2 d.4.1.5 (B:1-103) Recombination endonuclease VII, C-terminal and dimerization domains {Bacteriophage T4}
mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
cdaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnn

SCOP Domain Coordinates for d1e7lb2:

Click to download the PDB-style file with coordinates for d1e7lb2.
(The format of our PDB-style files is described here.)

Timeline for d1e7lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e7lb1