PDB entry 1e7l

View 1e7l on RCSB PDB site
Description: endonuclease vii (endovii) n62d mutant from phage t4
Deposited on 2000-08-29, released 2001-05-04
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-16, with a file datestamp of 2001-08-16.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.145
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7lA (A:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cdaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e7lB (B:)
    mlltgklykeekqkfydaqngkclicqrelnpdvqanhldhdhelngpkagkvrgllcnl
    cdaaegqmkhkfnrsglkgqgvdylewlenlltylksdytqnnihpnfvgdkskefsrlg
    keemmaemlqrgfeynesdtktqliasfkkqlrkslk