![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
![]() | Superfamily c.23.5: Flavoproteins [52218] (3 families) ![]() |
![]() | Family c.23.5.2: NADPH-cytochrome p450 reductase, N-terminal domain [52231] (1 protein) |
![]() | Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [52233] (4 PDB entries) |
![]() | Domain d1j9zb2: 1j9z B:64-239 [62796] Other proteins in same PDB: d1j9za1, d1j9za3, d1j9zb1, d1j9zb3 |
PDB Entry: 1j9z (more details), 2.7 Å
SCOP Domain Sequences for d1j9zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9zb2 c.23.5.2 (B:64-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus)} vkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladls slpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfna mgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee
Timeline for d1j9zb2: