Lineage for d1j9zb2 (1j9z B:64-239)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856501Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins)
  6. 2856502Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species)
  7. 2856505Species Norway rat (Rattus norvegicus) [TaxId:10116] [52233] (4 PDB entries)
  8. 2856511Domain d1j9zb2: 1j9z B:64-239 [62796]
    Other proteins in same PDB: d1j9za1, d1j9za3, d1j9zb1, d1j9zb3
    complexed with fad, fmn, nap

Details for d1j9zb2

PDB Entry: 1j9z (more details), 2.7 Å

PDB Description: cypor-w677g
PDB Compounds: (B:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d1j9zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9zb2 c.23.5.2 (B:64-239) NADPH-cytochrome p450 reductase, N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladls
slpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfna
mgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee

SCOPe Domain Coordinates for d1j9zb2:

Click to download the PDB-style file with coordinates for d1j9zb2.
(The format of our PDB-style files is described here.)

Timeline for d1j9zb2: