Lineage for d1ic0b_ (1ic0 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2044599Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 2044613Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 2044614Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 2044624Domain d1ic0b_: 1ic0 B: [62242]
    complexed with cu

Details for d1ic0b_

PDB Entry: 1ic0 (more details), 2.1 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea
PDB Compounds: (B:) nitrosocyanin

SCOPe Domain Sequences for d1ic0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic0b_ b.6.1.4 (B:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]}
hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOPe Domain Coordinates for d1ic0b_:

Click to download the PDB-style file with coordinates for d1ic0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ic0b_: