Lineage for d1ic0b_ (1ic0 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56339Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 56353Protein Red copper protein nitrosocyanin [63688] (1 species)
  7. 56354Species Nitrosomonas europaea [TaxId:915] [63689] (3 PDB entries)
  8. 56364Domain d1ic0b_: 1ic0 B: [62242]

Details for d1ic0b_

PDB Entry: 1ic0 (more details), 2.1 Å

PDB Description: red copper protein nitrosocyanin from nitrosomonas europaea

SCOP Domain Sequences for d1ic0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic0b_ b.6.1.4 (B:) Red copper protein nitrosocyanin {Nitrosomonas europaea}
hnfnvvinaydttipelnvegvtvknirafnvlnepetlvvkkgdavkvvvenkspiseg
fsidafgvqevikagetktisftadkagaftiwcqlhpknihlpgtlnvve

SCOP Domain Coordinates for d1ic0b_:

Click to download the PDB-style file with coordinates for d1ic0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ic0b_: