Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.1: CAD domain [54278] (3 proteins) |
Protein Caspase-activated DNase (CAD), DFF40, N-terminal domain [54281] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [64223] (1 PDB entry) |
Domain d1ibxa_: 1ibx A: [62231] Other proteins in same PDB: d1ibxb_ |
PDB Entry: 1ibx (more details)
SCOPe Domain Sequences for d1ibxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibxa_ d.15.2.1 (A:) Caspase-activated DNase (CAD), DFF40, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mlqkpksvklralrsprkfgvagrscqevlrkgclrfqlpergsrlclyedgteltedyf psvpdnaelvlltlgqawqgh
Timeline for d1ibxa_: