Lineage for d1ibkn_ (1ibk N:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043156Domain d1ibkn_: 1ibk N: [62177]
    complexed with mg, par, zn

Details for d1ibkn_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1ibkn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkn_ i.1.1.1 (N:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1ibkn_:

Click to download the PDB-style file with coordinates for d1ibkn_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkn_: